PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00002549001
Common NameGSBRNA2T00002549001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 293aa    MW: 31712.7 Da    PI: 6.6721
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00002549001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.19.6e-343791155
              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  GSBRNA2T00002549001 37 KPRLRWTAELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKFRL 91
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-323493IPR009057Homeodomain-like
PROSITE profilePS5129411.9383494IPR017930Myb domain
SuperFamilySSF466895.55E-173692IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-243792IPR006447Myb domain, plants
PfamPF002497.1E-83989IPR001005SANT/Myb domain
PfamPF143791.1E-26135181IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MYSAIRSLPL DGGDYHGPLD GTNLPGDACL VLTTDPKPRL RWTAELHERF VDAVTQLGGP  60
DKATPKTIMR TMGVKGLTLY HLKSHLQKFR LGRQACKDST DNSKDASCVG ESQDTGSSSS  120
SSLRMAAQEQ NEGYQVTEAL RAQMEVQRRL HEQLEVQRRL QLRIEAQGKY LQSILEKACK  180
AFDDQAAAFV GLEAAREELS ELAIKVSNSS QGTAVPFFDT TKMMMMPSLS ELAVAVDTKN  240
NITTNCSVES SLTSNTNGSS VSAASMKKRL RGDDVGLGYE AGWNVPSSST IG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.134790.0seed
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00002549001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0503550.0AY050355.1 Arabidopsis thaliana AT3g24120/MUJ8_3 mRNA, complete cds.
GenBankAY0884280.0AY088428.1 Arabidopsis thaliana clone 6626 mRNA, complete sequence.
GenBankAY0940460.0AY094046.1 Arabidopsis thaliana AT3g24120/MUJ8_3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009106171.10.0PREDICTED: myb family transcription factor APL-like isoform X2
SwissprotQ9SAK51e-67APL_ARATH; Myb family transcription factor APL
TrEMBLA0A078G0E80.0A0A078G0E8_BRANA; BnaA01g23340D protein
STRINGBra028359.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35152561
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.10.0G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]